PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G32980.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 272aa    MW: 30571.9 Da    PI: 10.4687
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G32980.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.2e-281059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +++fsstg+lye+ss
  ORUFI02G32980.2 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLVVFSSTGRLYEFSS 59
                     8***********************************************96 PP

2K-box56.99.2e-201372191597
            K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      + +q+e+a L+++++nLq+++++l+Ge+L+ L +++Lq Le++Le  l++iR +K  l++++  el +  + +++++ +L +k
  ORUFI02G32980.2 137 KIWQREAASLRQQLHNLQESHKQLMGEELSGLGVRDLQGLENRLEINLRNIRMRKGSLIHQENIELSRSLNVMSQQKLELYNK 219
                      569*********************************************************99988888888888887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.17161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002658.47E-43277No hitNo description
SuperFamilySSF554557.59E-32274IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003199.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.81136233IPR002487Transcription factor, K-box
PfamPF014866.5E-18138219IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGLVVFSS TGRLYEFSST  60
NMKTVIDRYT NAKEELLGGN ATSEIKHLRA SGQAILKFAN DGKSMHILTS NVQPKKRMKI  120
IREVQCANFS ARSLGPKIWQ REAASLRQQL HNLQESHKQL MGEELSGLGV RDLQGLENRL  180
EINLRNIRMR KGSLIHQENI ELSRSLNVMS QQKLELYNKA CEQRGATDAN ESSSTPYSFR  240
IIQNANMPPS LELSQSQQRE GECSKTAAPE LG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-21174174Myocyte-specific enhancer factor 2B
1tqe_Q8e-21174174Myocyte-specific enhancer factor 2B
1tqe_R8e-21174174Myocyte-specific enhancer factor 2B
1tqe_S8e-21174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8353720.0CT835372.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI222G19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626794.11e-144PREDICTED: MADS-box transcription factor 57 isoform X1
SwissprotQ6Z6W21e-146MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A0E0NKJ00.0A0A0E0NKJ0_ORYRU; Uncharacterized protein
STRINGLOC_Os02g49840.11e-144(Oryza sativa Japonica Group)
STRINGORGLA02G0267800.11e-144(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.18e-75AGAMOUS-like 16